Skip to Content

ELISA Recombinant Suid herpesvirus 1 Envelope protein US9 homolog

https://www.anagnostics.com/web/image/product.template/159217/image_1920?unique=b3f4f0f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Suid herpesvirus 1 (strain Rice) (SuHV-1) (Pseudorabies virus (strain Rice)) Uniprot NO.:P11313 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPTAAPADMDTFDPSAPVPTSVSNPAADVLLAPKGPRSPLRPQDDSDCYYSESDNETPSE FLRRVGRRQAARRRRRRCLMGVAISAAALVICSLSALIGGIIARHV Protein Names:Recommended name: Envelope protein US9 homolog Alternative name(s): 11 kDa protein Gene Names: Expression Region:1-106 Sequence Info:fµLl length protein

1,447.00 € 1447.0 EUR 1,447.00 €

1,447.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.