ELISA Recombinant Zea mays Chlorophyll a-b binding protein 1, chloroplastic(CAB1)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Zea mays (Maize)
Uniprot NO.:P12329
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:RKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHSRWAmLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIH AQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE LKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGN
Protein Names:Recommended name: Chlorophyll a-b binding protein 1, chloroplastic Alternative name(s): LHCII type I CAB-1 Short name= LHCP
Gene Names:Name:CAB1
Expression Region:31-262
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.