ELISA Recombinant Zea mays Chlorophyll a-b binding protein 1, chloroplastic(CAB1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:P12329 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:RKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHSRWAmLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIH AQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE LKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGN Protein Names:Recommended name: Chlorophyll a-b binding protein 1, chloroplastic Alternative name(s): LHCII type I CAB-1 Short name= LHCP Gene Names:Name:CAB1 Expression Region:31-262 Sequence Info:fµLl length protein