ELISA Recombinant Vicia faba Photosystem Q(B) protein

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vicia faba (Broad bean) (Faba vµLgaris) Uniprot NO.:P13910 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:TAILERRDSENLWGRFCNWITTTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAVIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIVVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHmLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA Protein Names:Recommended name: Photosystem Q(B) protein EC= 1.10.3.9 Alternative name(s): 32 kDa thylakoid membrane protein Photosystem II protein D1 Gene Names:Name:psbA Expression Region:2-344 Sequence Info:fµLl length protein