ELISA Recombinant Pseudomonas phage phi6 Fusion protein P6(P6)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas phage phi6 (Bacteriophage phi-6) Uniprot NO.:P11128 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SIFSSLFKVIKKVISKVVATLKKIFKKIWPLLLIVAIIYFAPYLAGFFTSAGFTGIGGIF SSIATTITPTLTSFLSTAWSGVGSLASTAWSGFQSLGMGTQLAVVSGAAALIAPEETAQL VTEIGTTVGDIAGTIIGGVAKALPGWIWIAAGGLAVWALWPSSDSKE Protein Names:Recommended name: Fusion protein P6 Gene Names:Name:P6 Expression Region:2-168 Sequence Info:fµLl length protein