Skip to Content

ELISA Recombinant Potato leafroll virus Protein P1-P2 (ORF1-ORF2)

https://www.anagnostics.com/web/image/product.template/150367/image_1920?unique=41ec440
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Potato leafroll virus (strain Potato/Netherlands/Wageningen/1989) (PLrV) Uniprot NO.:P11623 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:STAVKGRVFSDETVKELEREASEAVKKLARFKSLTGKNWANDYDSDEDYGLEKEAATNAP AEKTAQTNSAEKTAPSTSAEKTAPTNKPFKWASGTARQNKRQLRHPRRRYKRTTNGQNGR TDHHSYGGENQSLGDRGEDSEQGVSESPAEAQTKQTRKTWREEQAKQFTSYFDAIYKWGA QEEGCPPGFRKCGNIPGYYHPRTKGETKWGQKLCQVHPELADKTAGFGWPKAGFEAELQS LNLQAARWLQRAESATIPGAEARKRVIEKTVEAYRNCITNAPLCSLKSKLDWAGFQQDIR EAVQSLELDAGVGIPYIAYGLPTHRGWVEDHKLLPVLTQLTFDRLQKMSEASFEDMSAEE LVQEGLCDPIRLFVKGEPHKQSKLDEGRYRLIMSVSLVDQLVARVLFQNQNKREISLWRS VPSKPGFGLSTDTQTAEFLECLQKVSGAPSVEELCANHKEHTRPTDCSGFDWSVAYWmLE DDMEVRNRLTFNNTQLTERLRAAWLKCIGNSVLCLSDGTLLAQTVPGVQKSGSYNTSSSN SRIRVMAAYHCGADWAMAMGDDALEAPNSDLEEYKTLGFKVEVGRELEFCSHIFRNPTLA VPVNTNKmLYKLIHGYNPECGNPEVIQNYLAAVFSVLQELRHDRELVAKLHQWLVPSATT KEH Protein Names:Recommended name: Protein P1-P2 Cleaved into the following 2 chains: 1. Serine protease EC= 2. 3.4.21.- 3. RNA-directed RNA polymerase EC= 4. 2.7.7.48 Alternative name(s): 69.6 kDa protein Gene Names:ORF Names:ORF1/ORF2 Expression Region:400-1062 Sequence Info:fµLl length protein

2,035.00 € 2035.0 EUR 2,035.00 €

2,035.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.