ELISA Recombinant Spinacia oleracea Photosystem I reaction center subunit V, chloroplastic(PSAG)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Spinacia oleracea (Spinach) Uniprot NO.:P12357 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ELSPSLVISLSTGLSLFLGRFVFFNFQRENMAKQVPEQNGMSHFEAGDTRAKEYVSLLKS NDPVGFNIVDVLAWGSIGHIVAYYILATASNGYDPSFF Protein Names:Recommended name: Photosystem I reaction center subunit V, chloroplastic Alternative name(s): PSI-G Photosystem I 9 kDa protein Gene Names:Name:PSAG Expression Region:70-167 Sequence Info:fµLl length protein