ELISA Recombinant Woodchuck hepatitis B virus Large envelope protein(S)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Woodchuck hepatitis B virus (isolate 7) (WHV) Uniprot NO.:P12909 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GNNIKVTFNPDKIAAWWPAVGTYYTTTYPQNQSVFQPGIYQTTSLINPKNQQELDSVLIN RYKQIDWNTWQGFPVDQKLPLVSRDPPPKPYINQSAQTFEIKPGPIIVPGIRDIPRGLVP PQTPTNRDQGRKPTPPTPPLRDTHPHLTMKNQTFHLQGFVDGLRDLTTTERQHNAYGDPF TTLSPAVPTVSTILSPPSTTGDPALSPEMSPSSLLGLLAGLQVVYFLWTKILTIAQNLDW WWTSLSFPGGIPECTGQNSQFQTCKHLPTSCPPTCNGFRWMYLRRFIIYLLVLLLCLIFL LVLLDWKGLIPVCPLQPTTETTVNCRQCTISAQDMYTPPYCCCLKPTAGNCTCWPIPSSW ALGNYLWEWALARFSWLNLLVPLLQWLGGISLIAWFLLIWMIWFWGPALLSILPPFIPIF VLFFLIWVYI Protein Names:Recommended name: Large envelope protein Alternative name(s): L glycoprotein L-HBsAg Short name= LHB Large S protein Large surface protein Major surface antigen Gene Names:Name:S Expression Region:2-431 Sequence Info:fµLl length protein