ELISA Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1C, chloroplastic(CAB1C)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Solanum lycopersicum (Tomato) (Lycopersicon escµLentum) Uniprot NO.:P14275 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRKAVAKSAPSSSPWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLVHA QSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEI KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK Protein Names:Recommended name: Chlorophyll a-b binding protein 1C, chloroplastic Alternative name(s): LHCII type I CAB-1C Short name= LHCP Gene Names:Name:CAB1C Expression Region:35-265 Sequence Info:fµLl length protein