ELISA Recombinant Spiroplasma virus SpV1-R8A2 B Uncharacterized protein ORF6 (ORF6)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Spiroplasma virus SpV1-R8A2 B (SpV1) (Spiroplasma virus 1)
Uniprot NO.:P15897
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDMKFWTTKEYKKIKRDFIIRNFAFGFCYFLFLISFIMCIVCFIISINFEVEIILVILFP FLLLILSVWNLFDLIMEHISEIKRFKVTVLKKQIEELEGKmLRGLRVGVDKIE
Protein Names:Recommended name: Uncharacterized protein ORF6 Alternative name(s): Gene 6 protein
Gene Names:ORF Names:ORF6
Expression Region:1-113
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.