ELISA Recombinant White clover mosaic virus Movement protein TGB2 (ORF3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:White clover mosaic virus (strain O) (WCMV) Uniprot NO.:P15404 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPLIPPPNPQKTYQIAVLALGLVLLLAFVLISDHSPKVGDHLHNLPFGGEYKDGTKTIKY FQRPNQHSLSKTLAKSHNTTIFLIILGLIGTLHGLHYFSNNRRISSSLHCVLCQNKH Protein Names:Recommended name: Movement protein TGB2 Alternative name(s): 13 kDa protein Triple gene block 2 protein Short name= TGBp2 Gene Names:ORF Names:ORF3 Expression Region:1-117 Sequence Info:fµLl length protein