ELISA Recombinant Rhizobium meliloti Nitrogen fixation protein fixH(fixH)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) Uniprot NO.:P18397 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTATKQRSPKRGFTGWHMVAVMSLFFGTVISVNLVMAWNASRSWSGLVVENTYVASQQF NGKVAEGRAFQASGIKGRLTTEPGAIRYVLTRNGEPEQKIDKVIAVLKRPVEEHEDLRVE LHPRGEGAFVLAEELKPGQWIAAMMAMAGDAVVHRQTIRFIAEGRDK Protein Names:Recommended name: Nitrogen fixation protein fixH Gene Names:Name:fixH Ordered Locus Names:RA0660 ORF Names:SMa1210 Expression Region:1-167 Sequence Info:fµLl length protein