ELISA Recombinant Xenopus laevis Gap junction alpha-2 protein(gja2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:P16864 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAGWELLKLLLDDVQEHSTLIGKVWLTVLFIFRIFILSVAGESVWTDEQSDFICNTQQPG CTNVCYDQAFPISHVRYWVLQFLFVSTPTLIYLGHMVYLSKKEEKERQKENESRILVANE AQTEVHSSATKKIRIQGPLMCTYTTSVVFKSIFEAGFLLGQWYIYGFVMSPIFVCERIPC KHKVECFVSRPMEKTIFIIFmLVVSLISLLLNLMELIHLSFKCFQHGIKEGATCSPTGIP FNGAGNRMPPQEYTNPPSSNQDIDLPSYNKMSGGHNWSRIQMEQQVNGLVKPKCQCDCWS QSAISVVVSGAPGIISNMDAVKSNHQTSSKQQYV Protein Names:Recommended name: Gap junction alpha-2 protein Alternative name(s): Connexin-38 Short name= Cx38 Gene Names:Name:gja2 Expression Region:1-334 Sequence Info:fµLl length protein