Skip to Content

ELISA Recombinant Potato leafroll virus Protein P1 (ORF1)

https://www.anagnostics.com/web/image/product.template/150366/image_1920?unique=41ec440
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Potato leafroll virus (strain Potato/Scotland/strain 1/1984) (PLrV) Uniprot NO.:P17519 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:STAVKGRVFSDEAVKELEREASEAVKKLARFKSLTDKNWADDYDSDEDYGLEREAATNAP AEKTAQTNSAEKTAPSTSAEKTALTNKPLNGQAAPSAKTNGNSDIPDAATSAPPMDKMVE QIITAMVGRINLSEIEEKIVSRVSQKALQKPKQKKRGRRGGKNKQNSLPPTSTQSTSGAP KKEAAPQASGSAGTSRATTTPAPEAKPSGGKNSAKFTPSWRIKQQDSAGQKPDLKLNSKA Protein Names:Recommended name: Protein P1 Alternative name(s): 69.7 kDa protein Genome-linked protein precursor Protein ORF1 Cleaved into the following 2 chains: 1. Serine protease EC= 2. 3.4.21.- 3. VPg/P1-C25 Gene Names:ORF Names:ORF1 Expression Region:400-639 Sequence Info:fµLl length protein

1,588.00 € 1588.0 EUR 1,588.00 €

1,588.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.