ELISA Recombinant Rhodobacter capsulatus Reaction center protein H chain(puhA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhodobacter capsµLatus (Rhodopseudomonas capsµLata) Uniprot NO.:P19056 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVGVNFFGDFDLASLAIWSFWAFLAYLIYYLQTENMREGYPLENDDGKLSPNQGPFPVPS PKTFDLADGRKIVVPSVENEEAHRRTDLALERTSVNEGYPFRPTGNPmLDGVGPASWVPR RDEPEVDAHGHNKIQPMRKTEMKVSAGRDPRGMPVQAGDTEVVGKIVDMWVDIPEQLVRY LEVELNSGKKKLLPMTmLKIWSDRVRVNAITSDLFDTIPDIKSPDVVTKLEEDKISAYVA GGYMYAKGVKPYAL Protein Names:Recommended name: Reaction center protein H chain Alternative name(s): Photosynthetic reaction center H subunit Gene Names:Name:puhA Expression Region:1-254 Sequence Info:fµLl length protein