ELISA Recombinant Saccharomyces cerevisiae Protein CBP3, mitochondrial(CBP3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P21560 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ETAQDSPELLAKSSHLNSKPLDVSNKAPVKTAQNKIPLAHSKYESSKYELPKWKEALGEL VIRAFHLDMDRVRAGPVAGSYYYKICKEQGLQYEDEPLSETAKYFYEDLKLPRTFSQWFQ ITVLHEWILFVRMRAMPFKYGRNYQQKLVDRTFSDIELRLFEEMKVNSGRIADQYLKDFN TQLRGAIFAYDEGFATDDGTLATAVWRNLFGGRKNIDMVHLESVVRYIYSQLYVLSRLSD REFATGKFKFVPPGVKVEKLTPKQEEELKAKTIAKYEALDKDPKTLPSERSRLSYTN Protein Names:Recommended name: Protein CBP3, mitochondrial Gene Names:Name:CBP3 Ordered Locus Names:YPL215W ORF Names:P1775 Expression Region:39-335 Sequence Info:fµLl length protein