ELISA Recombinant Zea mays Oleosin Zm-II(OLE18)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:P21641 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ADRDRSGIYGGAHATYGQQQQQGGGGRPMGEQVKKGmLHDKGPTASQALTVATLFPLGGL LLVLSGLALTASVVGLAVATPVFLIFSPVLVPAALLIGTAVMGFLTSGALGLGGLSSLTC LANTARQAFQRTPDYVEEARRRMAEAAAQAGHKTAQAGQAIQGRAQEAGTGGGAGAGAGG GGRASS Protein Names:Recommended name: Oleosin Zm-II Alternative name(s): Lipid body-associated protein L2 Oleosin 18 kDa Gene Names:Name:OLE18 Synonyms:OLE3 Expression Region:2-187 Sequence Info:fµLl length protein