ELISA Recombinant Streptomyces coelicolor Probable glycerol uptake facilitator protein(glpF)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) Uniprot NO.:P19255 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSSSDIFIGETIGTALLILLGGGVCAAVTLKASKARNAGWLAIAFGWGFAVMTAAYISGP LSGAHLNPAVTVGIAIKDGDWSNTPTYFAGQLLGAMIGAVLVWVAYYGQFQAHLTDREIV GGPGAQDTTAKSVEAQEKGAGPVLGVFSTGPEIRHTVQNLATEIIGTFVLLLAILTQGLN DEGNGLGILGALITGFVVVSIGLSLGGPTGYAINPVRDLGPRIVHALLPLPNKGGSDWSY AWIPVVGPLIGGAIAGGVYNVAFA Protein Names:Recommended name: Probable glycerol uptake facilitator protein Gene Names:Name:glpF Synonyms:gylA Ordered Locus Names:SCO1659 ORF Names:SCI52.01 Expression Region:1-264 Sequence Info:fµLl length protein