ELISA Recombinant Vaccinia virus Protein E8 (E8R)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Vaccinia virus (strain Copenhagen) (VACV) Uniprot NO.:P21049 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAATVPRFDDVYKNAQRRILDQETFFSRGLSRPLMKNTYLFDNYAYGWIPETAIWSSRYA NLDASDYYPISLGLLKKFEFLMSLYKGPIPVYEEKVNTEFIANGSFSGRYVSYLRKFSAL PTNEFISFLLLTSIPIYNILFWFKNTQFDITKHTLFRYVYTDNAKHLALARYMHQTGDYK PLFSRLKENYIFTGPVPICIKDIDHPNLSRARSPSDYETLANISTILYFTKYDPVLMFLL FYVPGYSITTKITPAVEYLMDKLNLTKSDVQLL Protein Names:Recommended name: Protein E8 Gene Names:ORF Names:E8R Expression Region:1-273 Sequence Info:fµLl length protein