Skip to Content

ELISA Recombinant Southern cowpea mosaic virus Replicase polyprotein P2AB (ORF2A-2B)

https://www.anagnostics.com/web/image/product.template/157695/image_1920?unique=263afdf
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Southern cowpea mosaic virus (SCPMV) (Southern bean mosaic virus (strain cowpea)) Uniprot NO.:P21405 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SFDGALPLNLLAGGRTQCLAAQIELGDYKFSCGPTHETGGMPFRNCGSSTCKFREVSRKP VADAVTAATKVFPELSELGWPERGSGAEIGSLLLQAGKFVPTKAPSNLEQAYNNLLSRYP RSKPLACFRQGTWSFDAIFEQVVSKATSAEINQKASPGVPLSRLATTNKDLMAQHMQFVA ACVTGRVPLLASFEDIHALSPTEMVEMGLCDPVRLFVKQEPHPSRKLKEGRYRLISSVSI VDQLVERmLFGAQNELEIAEWQSIPSKPGMGLSVIHQADAIFRDLRVKHTVCPAAEADIS GFDWSVQDWELWADVEMRIVLGSFPPMMARAARNRFSCFMNSVLQLSNGQLLQQELPGIM KSGSYCTSSTNSRIRCLMAELIGSPWCIAMGDDSVEGFVEGAREKYAGLGHLCKDYKPCA TTPTGQLYAVEFCSHVIKRNKAFLTSWPKTLYRFLSTPRETLEDLERELASSPMWHKIQS YVRSIPSPDKTARDKSICNGYPLDQEAISTSYSEYSSKSASAEATREAACCAGAQAYPSW GIHGPYCSGDHGEA Protein Names:Recommended name: Replicase polyprotein P2AB Cleaved into the following 4 chains: 1. N-terminal protein 2. Serine protease EC= 3. 3.4.21.- 4. VPg 5. RNA-directed RNA polymerase EC= 6. 2.7.7.48 Alternative name(s): RdR Gene Names:ORF Names:ORF2A-2B Expression Region:403-956 Sequence Info:fµLl length protein

1,920.00 € 1920.0 EUR 1,920.00 €

1,920.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.