ELISA Recombinant Pinus sylvestris Chlorophyll a-b binding protein type 2 member 2

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pinus sylvestris (Scots pine) Uniprot NO.:P15192 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ELLVKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYR VGGGPLGEGLDPLYPGDAFDPLGLADDPEAKAELKVKEIKNGRLAMFSMFGFFVQAIVTG KGPIENLYDHLADPVANNAWAYATNFVPGK Protein Names:Recommended name: Chlorophyll a-b binding protein type 2 member 2 Alternative name(s): Chlorophyll a-b binding protein type II 2 Short name= CAB LHCP Gene Names: Expression Region:1-150 Sequence Info:fµLl length protein