ELISA Recombinant Thermosynechococcus vulcanus Photosystem I reaction center subunit PsaK(psaK)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Thermosynechococcus vµLcanus (Synechococcus vµLcanus)
Uniprot NO.:P23318
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TLPDTTWTPSVGLVVILSNLFAIALGRYAIQSRGKGPGLPIALPALFEGFGLPELLATTS FGHLLAAGVVSVGLQYAGAL
Protein Names:Recommended name: Photosystem I reaction center subunit PsaK Alternative name(s): Light-harvesting 6.5 kDa polypeptide Photosystem I subunit X
Gene Names:Name:psaK
Expression Region:6-85
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.