ELISA Recombinant Saccharomyces cerevisiae Elongation of fatty acids protein 2(FEN1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P25358 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNSLVTQYAAPLFERYPQLHDYLPTLERPFFNISLWEHFDDVVTRVTNGRFVPSEFQFIA GELPLSTLPPVLYAITAYYVIIFGGRFLLSKSKPFKLNGLFQLHNLVLTSLSLTLLLLMV EQLVPIIVQHGLYFAICNIGAWTQPLVTLYYMNYIVKFIEFIDTFFLVLKHKKLTFLHTY HHGATALLCYTQLMGTTSISWVPISLNLGVHVVMYWYYFLAARGIRVWWKEWVTRFQIIQ FVLDIGFIYFAVYQKAVHLYFPILPHCGDCVGSTTATFAGCAIISSYLVLFISFYINVYK RKGTKTSRVVKRAHGGVAAKVNEYVNVDLKNVPTPSPSPKPQHRRKR Protein Names:Recommended name: Elongation of fatty acids protein 2 EC= 2.3.1.n8 Alternative name(s): 3-keto acyl-CoA synthase ELO2 Protein GNS1 v-SNARE bypass mutant gene 2 protein Gene Names:Name:FEN1 Synonyms:ELO2, GNS1, VBM2 Ordered Locus Names:YCR034W ORF Names:YCR34W, YCR521 Expression Region:1-347 Sequence Info:fµLl length protein