ELISA Recombinant Porcine respiratory coronavirus Non-structural protein 3b (3b)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Porcine respiratory coronavirus (strain RM4) (PRCoV) (PRCV) Uniprot NO.:P24414 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIGGLFLNTLSFVIVSNHPIVNNTANVHHIQQERVIVQQHHVVSARTQNYYPEFSIAVLF VSFLALYRSTNFKTCVGILMFKILSMTLLGPmLIAYGYYIDGIVTTTVLSLRFAYLAYFW YVNSRFEFILYNTTTLMFVHGRAAPFKRSSHSSIYVTLYGGINYMFVNDLTLHFVDPmLV SIAIRGLAHADLTVVRAVELLNGDFIYVFSQEPVVGVYNAAFSQAVLNEIDLKEEEGDRT YDVS Protein Names:Recommended name: Non-structural protein 3b Short name= ns3b Alternative name(s): Accessory protein 3b Non-structural protein 3-1 Gene Names:ORF Names:3b Expression Region:1-244 Sequence Info:fµLl length protein