ELISA Recombinant Roseobacter denitrificans Reaction center protein M chain(pufM)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans) Uniprot NO.:P26279 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MYPEYQNIFTQVQVRGTPEMGMDDAGNNMMEERVGKPFFSTLAGLFGNGQIGPYYFGWTS IVAFGTGIAWFVIVGFNmLAQVGWSIPQFIRQLFWLALEPPSPEYGLSMPPLNDGGWYII ASFFLLVSVMTWLLRAYLLAEQHKMGKHIFWGFAAAVWLFLVLGLFRPILMGSWSEAVPY GIFPHLDWTTAFSIRYGNLYYNPFHCLSIVFLYGSVLLFCMHGGTILAVTRYGGDRELEQ IYDRGTATERAALFWRWTMGFNATMEGIHRWAWWFAVLTPITGGIGILLTGTVVDNWFIW AQEHHFAPMYDGSYGYEDYGSYEAFIGKEN Protein Names:Recommended name: Reaction center protein M chain Alternative name(s): Photosynthetic reaction center M subunit Gene Names:Name:pufM Ordered Locus Names:RD1_0103 Expression Region:1-330 Sequence Info:fµLl length protein