ELISA Recombinant Saccharomyces cerevisiae Mitochondrial outer membrane protein OM14(OM14)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P38325 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSATAKHDSNASPNSDSEDGHHHNNKKECAIEYLKARLNSASAVACGYLQAFVSKTQDFA KVCFLELQNPVVLVNLLLHSSVVCYLCNGYANHNARFLKGKPNSTVLATTAGALGLLTLD GIISKKYYSRYDKK Protein Names:Recommended name: Mitochondrial outer membrane protein OM14 Alternative name(s): Outer membrane protein of 14 kDa Gene Names:Name:OM14 Ordered Locus Names:YBR230C ORF Names:YBR1527 Expression Region:1-134 Sequence Info:fµLl length protein