ELISA Recombinant Saccharomyces cerevisiae 3-hydroxyacyl-CoA dehydratase PHS1(PHS1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P40857 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSKKLASPLSFLPLYNLLSAVGWSYLLYLVISLYPKVGQPAFFYQTKNVATLVQCGAIIE IINSFLGVVRSPLLTTVAQVSSRLLVVLGIFQLLPNTSGVQSVVYISLLLAWSITEIVRY LYYFFmLVFKNGAPKILILLRYNLFWILYPTGVASELRIIYCALNAAESQYSLLYKRILI AAmLAYIPGFPmLFLHMVAQRKKVMKSLRSSFGKKLI Protein Names:Recommended name: 3-hydroxyacyl-CoA dehydratase PHS1 Short name= HACD EC= 4.2.1.- Alternative name(s): PTPLA homolog involved in sphingolipid biosynthesis protein 1 Gene Names:Name:PHS1 Ordered Locus Names:YJL097W ORF Names:J0902 Expression Region:1-217 Sequence Info:fµLl length protein