ELISA Recombinant Thiobacillus ferrooxidans ATP synthase subunit c(atpE)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Thiobacillus ferrooxidans (Acidithiobacillus ferrooxidans)
Uniprot NO.:P41173
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDAHTIIVAATAIAVGIIFGAAGLGSAIGWGLITSKTIEGITRQPEMRPQLLVNTFIFAG LMESFPFIILAFGFWFLFANPFLG
Protein Names:Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein
Gene Names:Name:atpE
Expression Region:1-84
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.