ELISA Recombinant Porcine transmissible gastroenteritis coronavirus Non-structural protein 3b (3b)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Porcine transmissible gastroenteritis coronavirus (strain FS772/70) (TGEV)
Uniprot NO.:P22656
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIGGLFLNTLSFVIVSNHSIVNNTANVHHIQQERVIVQQHQVVSAITQNYYPEFSIAVLF VSFLALYRSTNFKTCVGILMFKILSMTLLGPmLIAYGYYIDGIVTTTVLSLRFAYLAYFW YVNSRFEFILYNTTTLMFVHGRAAPFKRSSHSSIYVTLYGGINYMFVNDLTLHFVDPmLV SIAIRGLAHADLTVVRAVELLNGDFIYVFSQEPVVGVYNAAFSQAVLNEIDLKEEEGDRT YDVS
Protein Names:Recommended name: Non-structural protein 3b Short name= ns3b Alternative name(s): Accessory protein 3b Non-structural protein 3-1 X2b protein
Gene Names:ORF Names:3b
Expression Region:1-244
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.