ELISA Recombinant Schistosoma mansoni Antigenic integral membrane glycoprotein

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schistosoma mansoni (Blood fluke) Uniprot NO.:P23126 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:DFSTEIIMIQTINWIVWKLFIIYISLDLFSLKLVNSEENSNSIITDEDYDHYNSSLDSSN NVKHSQEAFHRNSDPDGFPEYEFLNETSIEIKEELGQELHQLQLILDELSRRIRATPNSA NKYMKNEFLMSSCIVITLNLFIFMYKS Protein Names:Recommended name: Antigenic integral membrane glycoprotein Alternative name(s): Antigen Sm25 Gene Names: Expression Region:36-182 Sequence Info:fµLl length protein