ELISA Recombinant Saccharomyces cerevisiae Mitochondrial phosphate carrier protein(MIR1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P23641 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSVSAAPAIPQYSVSDYMKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSF KQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMG SAAMAEFLADIALCPLEATRIRLVSQPQFANGLVGGFSRILKEEGIGSFYSGFTPILFKQ IPYNIAKFLVFERASEFYYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLS KVNKTKKAPGQSTVGLLAQLAKQLGFFGSFAGLPTRLVMVGTLTSLQFGIYGSLKSTLGC PPTIEIGGGGH Protein Names:Recommended name: Mitochondrial phosphate carrier protein Alternative name(s): Mitochondrial import receptor Phosphate transport protein Short name= PTP mPic 1 p32 Gene Names:Name:MIR1 Ordered Locus Names:YJR077C ORF Names:J1837 Expression Region:1-311 Sequence Info:fµLl length protein