ELISA Recombinant Vaccinia virus Plaque-size-host range protein(PS-HR),partial

Quantity: 10µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 15-20 working days Research Topic: Others Uniprot ID: P24083 Gene Names: PS/HR Organism: Vaccinia virus (strain Lister) (VACV) AA Sequence: VYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYITINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEKFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH Expression Region: 18-279aa Sequence Info: ExtracellµLar Domain Source: in vitro E.coli expression system Tag Info: N-terminal 6xHis-tagged MW: 33.2 kDa Alternative Name(s): Protein B5 Relevance: RegµLation of plaque Quantity and host range. Reference: "RegµLation of plaque Quantity and host range by a vaccinia virus gene related to complement system proteins."Takahashi-Nishimaki F., Funahashi S., Miki K., Hashizume S., Sµgimoto M.Virology 181:158-164(1991) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.