ELISA Recombinant Solanum tuberosum ADP,ATP carrier protein, mitochondrial(ANT)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Solanum tuberosum (Potato) Uniprot NO.:P25083 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:PQEKGFAAFATDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEmLKAGRLSEPYKGIGECF GRTIKEEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLAS GGAAGASSLFFVYSLDYARTRLANDRKASKKGGERQFNGLVDVYKKTLKSDGIAGLYRGF NISCVGIIVYRGLYFGMYDSLKPVLLTGNLQDSFFASFGLGWLITNGAGLASYPIDTVRR RMMMTSGEAVKYKSSLDAFSQIVKNEGPKSLFKGAGANILRAVAGAGVLAGYDKLQVLVL GKKFGSGGA Protein Names:Recommended name: ADP,ATP carrier protein, mitochondrial Alternative name(s): ADP/ATP translocase Adenine nucleotide translocator Short name= ANT Gene Names:Name:ANT Expression Region:78-386 Sequence Info:fµLl length protein