ELISA Recombinant Saccharomyces cerevisiae V-type proton ATPase subunit c(VMA3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P25515 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTELCPVYAPFFGAIGCASAIIFTSLGAAYGTAKSGVGICATCVLRPDLLFKNIVPVIMA GIIAIYGLVVSVLVCYSLGQKQALYTGFIQLGAGLSVGLSGLAAGFAIGIVGDAGVRGSS QQPRLFVGMILILIFAEVLGLYGLIVALLLNSRATQDVVC Protein Names:Recommended name: V-type proton ATPase subunit c Short name= V-ATPase subunit c Alternative name(s): Guanine nucleotide exchange factor 2 V-ATPase 16 kDa proteolipid subunit 1 Vacuolar proton pump c subunit Gene Names:Name:VMA3 Synonyms:CLS7, CUP5, GEF2 Ordered Locus Names:YEL027W Expression Region:1-160 Sequence Info:fµLl length protein