ELISA Recombinant Rat Olfactory receptor-like protein I15

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P23274 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTEENQTVISQFLLLFLPIPSEHQHVFYALFLSMYLTTVLGNLIIIILIHLDSHLHTPMY LFLSNLSFSDLCFSSVTMPKLLQNMQSQVPSIPFAGCLTQLYFYLYFADLESFLLVAMAY DRYVAICFPLHYMSIMSPKLCVSLVVLSWVLTTFHAmLHTLLMARLSFCADNMIPHFFCD ISPLLKLSCSDTHVNELVIFVMGGLVIVIPFVLIIVSYARVVASILKVPSVRGIHKIFST CGSHLSVVSLFYGTIIGLYLCPSANNSTVKETVMAMMYTVVTPmLNPFIYSLRNRDMKEA LIRVLCKKKITFCL Protein Names:Recommended name: Olfactory receptor-like protein I15 Gene Names: Expression Region:1-314 Sequence Info:fµLl length protein