ELISA Recombinant Saccharomyces cerevisiae Peptidyl-prolyl cis-trans isomerase CPR4(CPR4)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P25334 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:APSSGKQITSKDVDLQKKYEPSPPATHRGIITIEYFDPVSKSMKEADLTFELYGTVVPKT VNNFAmLAHGVKAVIEGKDPNDIHTYSYRKTKINKVYPNKYIQGGVVAPDVGPFTVYGPK FDDENFYLKHDRPERLAMAYFGPDSNTSEFIITTKADGNEELDGKSVVFGQITSGLDQLM DAIQYTETDEYGKPQHELRFLYFVLEILKISNILDLHAAYTEKVEKFRNGDVSVGSTLEN IFRNDKAYTPLTTSTGTTAYDLNHPISRALMCLTVLGLCFIAYKGMHEKPHTVSLRHK Protein Names:Recommended name: Peptidyl-prolyl cis-trans isomerase CPR4 Short name= PPIase CPR4 EC= 5.2.1.8 Alternative name(s): Rotamase Gene Names:Name:CPR4 Synonyms:CYP4, SCC3 Ordered Locus Names:YCR069W ORF Names:YCR69W/YCR70W Expression Region:21-318 Sequence Info:fµLl length protein