ELISA Recombinant Rhodobacter capsulatus Heme exporter protein B(helB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhodobacter capsµLatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) Uniprot NO.:P29960 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRALLSRDLRLAIRAGGGFGLGLAFFLIVVTLVPFGVGPQGEILARIASGILWLGALLAC LLSLDRIFALDFEDGSLDLLATAPIPMEAVVTIKALAHWITTGLPLVLAAPLFAVLLHLP APAYLWLEVSLLLGTPALSVLGTFGAALTVGLKRGGLLLPLLALPLYVPTLIFGAELVRR GAEGLAIEVPLAmLAGITAATVALVPFASAAAIRVNLR Protein Names:Recommended name: Heme exporter protein B Alternative name(s): Cytochrome c-type biogenesis protein HelB Gene Names:Name:helB Synonyms:ccmB Ordered Locus Names:RCAP_rcc01786 Expression Region:1-218 Sequence Info:fµLl length protein