ELISA Recombinant Yersinia enterocolitica Outer membrane virulence protein YopE(yopE)

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 10µg Updated Date: Stock Protein updated on 20171228 Research areas: Others Target / Protein: yopE Biologically active: Not Tested Expression system: in vitro E.coli expression system Species of origin: Yersinia enterocolitica Delivery time: 3-7 business days Uniprot ID: P31492 AA Sequence: MKISSFISTSLPLPASVSGSSSVGEMSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHSVIGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAASAYVASGVDLTQAANEIKGLGQQMQQLLSLM Tag info: N-terminal 6xHis-tagged Expression Region: 1-219aa Protein length: FµLl Length MW: 26.9 kDa Alternative Name(s): Relevance: Essential virµLence determinant; cytotoxic effector, involved in resistance to phagocytosis Reference: "Secretion of Yop proteins by Yersiniae."Michiels T., Wattiau P., Brasseur R., Ruysschaert J.M., Cornelis G.Infect. Immun. 58:2840-2849(1990) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.