ELISA Recombinant Tacaribe virus Pre-glycoprotein polyprotein GP complex(GPC)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Tacaribe virus (strain V5) (TCRV)
Uniprot NO.:P31841
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AFFSWSLTDPLGNVPPGGYCLEKWmLVASELKCFGNTAIAKCNQNHDSEFCDmLRLFDYN KNAIKTLNEETKTRVNVLSHTINALISDNLLMKNKIRELMSVPYCNYTRFWYVNHTLSGQ HSLPRCWMIRNNSYLNSSEFRNEWILESDFLISEmLSKEYSERQGRTPITLVDICFWSTV FFTSTLFLHLIGFPTHEHIRGEGCPLPHRLNSMGGCRCGKYLPLKKPTIWHRRH
Protein Names:Recommended name: Pre-glycoprotein polyprotein GP complex Short name= Pre-GP-C Cleaved into the following 3 chains: 1. Stable signal peptide Short name= 2. SSP 3. Glycoprotein G1 Short name= 4. GP1 5. Glycoprotein G2
Gene Names:Name:GPC Synonyms:GP-C
Expression Region:250-483
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.