ELISA Recombinant Swinepox virus G-protein coupled receptor homolog C3 (C3L)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Swinepox virus (strain Kasza) (SWPV) Uniprot NO.:P32229 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSDCIFVFQIPFIVYSKLDQWIFGNILCKIMSVLYYVGFFSNMFIITLMSIDRYFAIVHP IKRQPYRTKRIGILMCCSAWLLSLILSSPVSKLYENIPHMSKDIYQCTLTNENDSIIAFI KRLMQIEITILGFLIPIIIFVYCYYRIFSTVVRLRNRRKYKSIKIVLMIVVCSLICWIPL YIVLMIATIVSLYTSNIFRHLCLYLNLAYAITFSETISLARCCINPIIYTLIGEHVRSRI SSICSCIYRDNRIRKKLFSRKSSSSSNII Protein Names:Recommended name: G-protein coupled receptor homolog C3 Gene Names:ORF Names:C3L Expression Region:1-269 Sequence Info:fµLl length protein