ELISA Recombinant Variola virus Protein L1 (L1R)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Variola virus (isolate /India/Ind3/1967) (VARV) (Smallpox virus) Uniprot NO.:P33040 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADA DAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAV VDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAG TGVQFYMIVIGVIILAALFMYYAKRmLFTSTNDKIKLILANKENVHWTTYMDTFFRTSPM VIATTDIQN Protein Names:Recommended name: Protein L1 Alternative name(s): Virion membrane protein M25 Gene Names:ORF Names:L1R Expression Region:2-250 Sequence Info:fµLl length protein