ELISA Recombinant Saccharomyces cerevisiae Peroxisomal membrane protein PEX34(PEX34)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P25584 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVSKKNTAEISAKDIWENIWSGVSSLLDFFAVLENLGVVNDKLYVSGLLRKVWLCYSCIS VIKCVWKLIKLCKVKFKIDQRLDGEGNGLVKDKLINFKKKYNEHIRHITAALLQDLSYLM VLIYPGTRLFKRLSNIITLCRIIV Protein Names:Recommended name: Peroxisomal membrane protein PEX34 Alternative name(s): Peroxin-34 Gene Names:Name:PEX34 Ordered Locus Names:YCL056C ORF Names:YCL433, YCL56C Expression Region:1-144 Sequence Info:fµLl length protein