ELISA Recombinant Synechocystis sp. Cytochrome b6-f complex iron-sulfur subunit 2(petC2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Synechocystis sp. (strain PCC 6803 / Kazusa) Uniprot NO.:P26290 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTQISGSPDVPDLGRRQFMNLLTFGTITGVAAGALYPAVKYLIPPSSGGSGGGVTAKDAL GNDVKVTEFLASHNAGDRVLAQGLKGDPTYIVVQGDDTIANYGINAVCTHLGCVVPWNAS ENKFMCPCHGSQYNAEGKVVRGPAPLSLALAHATVTDDDKLVLSTWTETDFRTDEDPWWA Protein Names:Recommended name: Cytochrome b6-f complex iron-sµLfur subunit 2 EC= 1.10.9.1 Alternative name(s): Plastohydroquinone:plastocyanin oxidoreductase iron-sµLfur protein 2 Short name= ISP 2 Short name= RISP 2 Rieske iron-sµLfur Gene Names:Name:petC2 Ordered Locus Names:sll1316 Expression Region:1-180 Sequence Info:fµLl length protein