ELISA Recombinant Xanthomonas campestris pv. campestris Type II secretion system protein F(xpsF)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xanthomonas campestris pv. campestris (strain ATCC 33913 / NCPPB 528 / LMG 568) Uniprot NO.:P31744 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPLYRYKALDAHGEmLDGQMEAANDAEVALRLQEQGHLPVETRLATGENGSPSLRmLLRK KPFDNAALVQFTQQLATLIGAGQPLDRALSILMDLPEDDKSRRVIADIRDTVRGGAPLSV ALERQHGLFSKLYINMVRAGEAGGSMQDTLQRLADYLERSRALKGKVINALIYPAILLAV VGCALLFLLGYVVPQFAQMYESLDVALPWFTQAVLSVGLLVRDWWLVLVVIPGVLGLWLD RKRRNAAFRAALDAWLLRQKVIGSLIARLETARLTRTLGTLLRNGVPLLAAIGIARNVMS NTALVEDVAAAADDVKNGHGLSMSLARGKRFPRLALQMIQVGEESGALDTmLLKTADTFE LETAQAIDRALAALVPLITLVLASVVGLVIISVLVPLYDLTNAIG Protein Names:Recommended name: Type II secretion system protein F Short name= T2SS protein F Alternative name(s): General secretion pathway protein F Gene Names:Name:xpsF Synonyms:pefF Ordered Locus Names:XCC0661 Expression Region:1-405 Sequence Info:fµLl length protein