Skip to Content

ELISA Recombinant Saccharomyces cerevisiae Golgi apparatus membrane protein TVP38(TVP38)

https://www.anagnostics.com/web/image/product.template/154332/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P36164 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSQSYEAGNANMGQGEDDEFDGYFEDFDNDIMPNSNNGQRVGTNAGLSFNDEVNVNDDDF LDIYNMSPRERLMHNIRKNVQKLQFYFYSLRLWQQIIIVLLGImLMIMGILLLVFHNAIL HKVVVTSNDLREKMSTHFILMVLIFFVAFPPMIGYSLLSTTTGLIYGVSFEGWVTLALGS VTGSIASFVVFKTILHSRAEKLVHLNRRFEALASILQENNSYWILALLRLCPFPYSLTNG AIAGVYGISVRNFSIANIITTPKLFIYLFIGSRVKSLAESESTGSRVFDLVSIIITLLIL SLTAWLLYFKTKKRYLELQNRDRQVSTDQLPELSFEV Protein Names:Recommended name: Golgi apparatus membrane protein TVP38 Alternative name(s): TLG2-vesicle protein of 38 kDa Gene Names:Name:TVP38 Ordered Locus Names:YKR088C ORF Names:YKR408 Expression Region:1-337 Sequence Info:fµLl length protein

1,691.00 € 1691.0 EUR 1,691.00 €

1,691.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.