Skip to Content

ELISA Recombinant Salmonella typhimurium Phosphoethanolamine transferase eptA(eptA)

https://www.anagnostics.com/web/image/product.template/155959/image_1920?unique=9b59aed
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) Uniprot NO.:P36555 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLKRFLKRPVLGQIAWLLLFSFYIAVCLNIAFYKQVLQDLPLNSLRNVLVFISMPVVAFS VVNSVLTLASFIWLNRLLACVFILVGAAAQYFILTYGIIIDRSMIANMMDTTPAETFALM TPQMVLTLGLSGVLAAVIAFWVKIRPATPRLRSGLYRLASVLISILLVILVAAFFYKDYA SLFRNNKQLIKALSPSNSIVASWSWYSHQRLANLPLVRIGEDAHRNPLmLKGDRKNLTIL IVGETSRGDDFSLGGYPRDTNPRLAKDDVIYFPHTTSCGTATAISVPCMFSDMPRKHYDE ELAHHQEGLLDIIQRAGINVLWNDNDGGCKGACDRVPHQNVTELNLPGQCIDGECYDEVL FHGLEDYIDHLKGDGVIVLHTIGSHGPTYYNRYPPQFKKFTPTCDTNEIQNCSQEQLINT YDNTVLYVDYIVDKAINLLKSHQDKFTTSLVYLSDHGESLGENGVYLHGLPYSIAPDTQK HVPmLIWLSKDYQQRYQVDQACLQKRASTLDYSQDNLFSTmLGLTGVQTTYYQAADDILQ PCRRLSE Protein Names:Recommended name: Phosphoethanolamine transferase eptA EC= 2.7.-.- Alternative name(s): Polymyxin resistance protein pmrC Gene Names:Name:eptA Synonyms:pagB, pmrC Ordered Locus Names:STM4293 Expression Region:1-547 Sequence Info:fµLl length protein

1,912.00 € 1912.0 EUR 1,912.00 €

1,912.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.