ELISA Recombinant Synechococcus elongatus Nitrate transport permease protein nrtB(nrtB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Synechococcus elongatus (strain PCC 7942) (Anacystis nidµLans R2) Uniprot NO.:P38044 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTVTLRPPSSVRRSAWVKNPKLKPFLPYVVCLPIFLAIWQVISAILGQDRLPGPINVVAN TWMPYIVEPFFDNGGTSKGLGLQILISLQRVAIGYLLAACTGILVGGVLGMSKFLGKGLD PVIQVLRTVPPLAWFPISLMVFQDANTSAIFVIFITAIWPIIINTAVGINQIPDDYNNVA RVLKLSKKDYILNILIPSTVPYVFAGLRIAVGLAWLAIVAAEmLKADGGIGYFIWDAYNA GGDGSSSQIILAIFYVGLVGLSLDRLVAWVGRLVSPVSR Protein Names:Recommended name: Nitrate transport permease protein nrtB Gene Names:Name:nrtB Ordered Locus Names:Synpcc7942_1238 Expression Region:1-279 Sequence Info:fµLl length protein