ELISA Recombinant Saccharomyces cerevisiae Alkaline ceramidase YPC1(YPC1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P38298 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGIFRWNYPESSVPGVWGETTSTIDWCEENYVVSPYIAEWSNTLTNSVFILSAIYTTYSA YKNKLEKRFLLIGFGYGLVGVGSWLFHMTLKYRFQLLDELPMIYAMCIPTWSLVCEAKEA LLNGDNHKKVPLFEQIFIGVIIGLAVTTASILYVIYKNVDIHQILFGVQIVVVAATAGSL TYRYVHDPLAKRNLKASMALGAILFLSGYISWLLDIHYCSFWVHVRRSILALPLGVLLEP HGWWHILTGMGIYFYIVSLEHLRVITLNVSCNYQFIWRWKVFPELIWKGRKPSTRYSLEL FGPYVEDQSIEVKKEK Protein Names:Recommended name: Alkaline ceramidase YPC1 EC= 3.5.1.- Gene Names:Name:YPC1 Ordered Locus Names:YBR183W ORF Names:YBR1305 Expression Region:1-316 Sequence Info:fµLl length protein