ELISA Recombinant Saccharomyces cerevisiae Elongation of fatty acids protein 1(ELO1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P39540 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVSDWKNFCLEKASRFRPTIDRPFFNIYLWDYFNRAVGWATAGRFQPKDFEFTVGKQPLS EPRPVLLFIAMYYVVIFGGRSLVKSCKPLKLRFISQVHNLmLTSVSFLWLILMVEQmLPI VYRHGLYFAVCNVESWTQPMETLYYLNYMTKFVEFADTVLMVLKHRKLTFLHTYHHGATA LLCYNQLVGYTAVTWVPVTLNLAVHVLMYWYYFLSASGIRVWWKAWVTRLQIVQFmLDLI VVYYVLYQKIVAAYFKNACTPQCEDCLGSMTAIAAGAAILTSYLFLFISFYIEVYKRGSA SGKKKINKNN Protein Names:Recommended name: Elongation of fatty acids protein 1 EC= 2.3.1.n8 Alternative name(s): 3-keto acyl-CoA synthase ELO1 Gene Names:Name:ELO1 Ordered Locus Names:YJL196C ORF Names:J0343 Expression Region:1-310 Sequence Info:fµLl length protein