Skip to Content

ELISA Recombinant Saccharomyces cerevisiae Cell division control protein 1(CDC1)

https://www.anagnostics.com/web/image/product.template/154242/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P40986 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVYRNRSKSVLSTHSKKSDDKAHYKSRSKKKSKSRSKKRLRIYWRYISIVWILWLGLISY YESVVVKRAMKKCQWSTWEDWPEGAESHRVGLFADPQIMDEYSYPGRPQIVNYFTRVIVD HYHRRNWKYVQYYLDPDSNFFLGDLFDGGRNWDDKQWIKEYTRFNQIFPKKPLRRTVMSL PGNHDIGFGDTVVESSLQRFSSYFGETSSSLDAGNHTFVLLDTISLSDKTNPNVSRVPRQ FLDNFAMGSHPLPRILLTHVPLWRDPEQQTCGQLRESKEPFPIQKGHQYQTVIENDISQE ILTKIQPEILFSGDDHDHCQISHSYPFQGKTKNAQEITVKSCAMNMGISRPAIQLLSLYN PSDLTMVNAGGEYASKTYQTELCYMPDPYKAIRMYLWGLLFSAAFIAYMHFFPKSFNNRV ATIMNRVFTRPDGNTSDLPLPTSISKSKSKKSLTHSKYAVNDTRSIKQFLVNAIVLFVSV MPIFIYFYTVV Protein Names:Recommended name: Cell division control protein 1 EC= 3.1.-.- Gene Names:Name:CDC1 Synonyms:DSR1, ESP2 Ordered Locus Names:YDR182W ORF Names:YD9395.16 Expression Region:1-491 Sequence Info:fµLl length protein

1,853.00 € 1853.0 EUR 1,853.00 €

1,853.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.